Checkout using your account
Checkout as a new customer
Creating an account has many benefits:
- See order and shipping status
- Track order history
- Check out faster
HALO PCS
HALO PCS (Positive Charged Surface) specifically for alkaline components
The HALO PCS series is the latest addition to the HALO product line. These new phases have a positively charged surface (PCS) to provide better peak shape for basic compounds and are based on AMT (Advanced Material Technology) fused core technology. For this reason, HALO PCS columns have a higher loading capacity and offer alternative selectivity compared to other conventional phases for use with low ionic strength mobile phases. HALO PCS phases are available with a C18 or phenyl-hexyl modification in particle sizes of 2.0, 2.7µm and in 90 and 160Å, and with an internal diameter of 1.5, 2.1, 3.0 and 4.6mm.
Applications
- Basic compounds
- Improved peak shape and higher loading capacity compared to unloaded phases
Technical Data
| Phase | Modification | Particle size | Pore size | End capping | C content | USP | Surface | pH range | Tmax |
| HALO PCS C18 | Positively charged surface C18 | 2.7 µm | 90 Å | + | 7.5 %C | L1 | 135 m²/g | 2.0 - 7.0 | 60°C 40°Cb |
| HALO PCS C18 | Positively charged surface C18 | 2.0 µm | 160 Å | + | 4.2 %C | L1 | 68 m²/g | 2.0 - 7.0 | 60°C 40°Cb |
2.7 µm | 5.0 %C | 90 m²/g | |||||||
| HALO PCS Phenyl-Hexyl | Positively charged surface Phenyl-Hexyl | 2.7 µm | 90 Å | + | 6.1 %C | L11 | 125 m²/g | 2.0 - 7.0 | 60°C 40°Cb |
a Low pH; b High pH
Applications
HALO 90 Å PCS C18, 2.7µm, 4.6x50mm
Batch-to-batch comparison shows reproducibility and good peak shapes for basic, acidic and neutral compounds
Peak Identities
1. Uracil
2. 2-Chlrobenzoic acid
3. 4-Methoxybenzoic acid
4. Imipramine
5. Dimethyl Phthalate
HALO 90 Å PCS C18, 2.7µm, 2.1x100mm
As shown in this basic drug screening with antidepressants, the HALO® Fused-Core® PCS technology tolerates a higher sample loading with basic substances compared to the competitor's fully porous C18 column. The positively charged surface (PCS) stationary phase is ideal for basic analytes when using low ionic strength mobile phases such as formic acid.
Peak Identities
1. Doxepin
2. Desipramine
3. Imipramine
4. Nortriptyline
5. Amitriptyline
6. Trimipramine
HALO 160 Å PCS C18, 2.7µm, 4.6x100mm
A HALO 160 Å PCS C18 column outperforms a conventional C18 column under formic acid conditions due to its positive charge surface which allows for improved peak shape and resolution for peptides. PCS C18 also allows for higher sample loading on the column for basic analytes and could potentially help pull apart tightly held impurities as seen below.
Peak Identities
1. 5Y Sequence: Ac-RGVVGLYLGK-NH2 (1102 Da)
* Impurity
Comparison of HALO 160Å PCS C18 2µm and 2.7µm
Compared to a HALO 160Å PCS C18 2.7µm column, a HALO 160Å PCS C18 2.0µm column delivers a 15% narrower peak width. This results in higher resolution, greater peak capacity and a more sensitive detection limit.
Peak identities
PEPTIDES: DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHPSNTK (carbamidomethylation)
Test conditions
Column: HALO 160Å PCS C18, 2.0µm, 100x2.1mm
HALO PCS Phenyl-Hexyl, 2.7µm, 2.1x100mm
- Alternative selectivity to HALO PCS C18
Peak Identities
1. Uracil
2. Phenol
3. Oxazepam
4. Flunitrazepam
5. Diazepam
6. 1-Chloro-4-nitrobenzene
7. Naphthalene
Downloads
Brochures
AMT HALO® PCS-Family HPLC Brochure
AMT HALO PCS C18 Separation of Short and Long Chain PFAS
The right column for you - we will be happy to support you individually
Competent consultants are always at your side. Write a message to our consultants, we will get back to you and give you individual support.
You will find:
Application support
Availability and delivery times
Price information with individual conditions
Certificates of analysis, MSDS, data sheets
Write us a message and we will get back to you as soon as possible.